PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006008P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 175aa    MW: 18199.1 Da    PI: 8.9917
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006008P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22e-393189260
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                    ++++l+cprC+s+ntkfCyynnysl+qPryfCkaCrryWt+GG+lrn+PvGgg+rkn+k
  MELO3C006008P1 31 PQEQLNCPRCKSSNTKFCYYNNYSLTQPRYFCKACRRYWTEGGSLRNIPVGGGSRKNRK 89
                    6899*****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-253089IPR003851Zinc finger, Dof-type
PfamPF027012.5E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8453589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MEAMMESGGN GGGGGGGGGG GGGGLKGKGR PQEQLNCPRC KSSNTKFCYY NNYSLTQPRY  60
FCKACRRYWT EGGSLRNIPV GGGSRKNRKP TGSVSGSGSV HHPQPQPQVY QAQDLNLGFA  120
TAEATTAMEN GGHGGFGCYI PNLMPYSGRE TAAVEENSGN NGYWNGMFGG GPPW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437866.11e-123PREDICTED: dof zinc finger protein DOF3.7-like
SwissprotQ433858e-37DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A0A0L5U83e-97A0A0A0L5U8_CUCSA; Uncharacterized protein
STRINGGLYMA16G02550.24e-40(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.31e-35Dof family protein